PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn201721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 317aa    MW: 34296.2 Da    PI: 8.2231
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn201721genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822213.26.5e-6651511149
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqssl 98 
                 g++gr ptw ErEnnkrRERrRRaiaaki++GLR+qG +klpk++DnneVlkALc+eAGwvvedDGttyrkg++p+ +++e+ag+ +++s +ss+q s+
  Achn201721   5 GSTGRLPTWNERENNKRRERRRRAIAAKIFTGLRSQGTFKLPKHCDNNEVLKALCAEAGWVVEDDGTTYRKGCRPPpTSTEIAGTMRNISACSSVQPSP 103
                 5899************************************************************************999******************** PP

      DUF822  99 kssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                 +ss+++spv+sy +sp+sssfpsp+++d+++++    ++p+l++l++++s+
  Achn201721 104 TSSSFPSPVPSYPTSPTSSSFPSPTRFDQNPSS---YIIPFLRNLTSIPSA 151
                 ******************************985...999**9999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.4E-627133IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTAGGSTGRL PTWNERENNK RRERRRRAIA AKIFTGLRSQ GTFKLPKHCD NNEVLKALCA  60
EAGWVVEDDG TTYRKGCRPP PTSTEIAGTM RNISACSSVQ PSPTSSSFPS PVPSYPTSPT  120
SSSFPSPTRF DQNPSSYIIP FLRNLTSIPS ALPPLRISNS APITPPLSSP TSRGSKRKVD  180
WESFSNGILN SFHHPLFAAS CPASPTRRHH VTPATIPECD ESDISTVDSG RWVNFQTVAA  240
PAAPSSPTFN LVKPVAQQSF LQDGHEELGW RSAAQRGCGS EFEFESGTVK AWEGERIHEI  300
GEDDLELTLG NGKACA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349751.11e-156PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ94A431e-109BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLM5VR331e-150M5VR33_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s12370.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94862128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-84BES1 family protein